PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.13G308200.1.p
Common NameGlyma13g38430.1, LOC100809556
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HD-ZIP
Protein Properties Length: 782aa    MW: 84641.8 Da    PI: 5.8349
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.13G308200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.31.8e-20109164156
                          TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          +++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k
  Glyma.13G308200.1.p 109 KKRYHRHTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMK 164
                          688999***********************************************999 PP

2START224.63.1e-703035221206
                          HHHHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
                START   1 elaeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                          ela +a++el+ +a+ +ep+W +     + +n+de++++f+++ +     ++ ea+r+++vv+m++++lve+l+d++ qW++ +a    +
  Glyma.13G308200.1.p 303 ELAVAAMEELIGMAQMGEPLWLTTLdgtTVLNEDEYIRSFPRGIGpkpagFKFEASRETAVVIMNHVNLVEILMDVN-QWSTVFAgivsR 391
                          57899********************99999************999********************************.************ PP

                          EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCE CS
                START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksngh 161
                          a+tlev+s+g      galq+m+ae q++splvp R+++fvRy++q+g+g+w++vdvS+d+ ++ p    ++R++++pSg+li++++ng+
  Glyma.13G308200.1.p 392 AMTLEVLSTGvagnynGALQVMTAEVQVPSPLVPtRESYFVRYCKQHGDGTWAVVDVSLDNLRPSP----SARCRRRPSGCLIQEMPNGY 477
                          ****************************************************************99....5******************* PP

                          EEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                START 162 skvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                          skv+wvehv++++r +h+l+++lv+sg+a+gak+wvatl+rqce+
  Glyma.13G308200.1.p 478 SKVIWVEHVEVDDRGVHNLYKQLVSSGHAFGAKRWVATLDRQCER 522
                          *******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-2388164IPR009057Homeodomain-like
SuperFamilySSF466891.92E-1999166IPR009057Homeodomain-like
PROSITE profilePS5007116.925106166IPR001356Homeobox domain
SMARTSM003891.2E-19107170IPR001356Homeobox domain
CDDcd000862.84E-19109167No hitNo description
PfamPF000464.4E-18109164IPR001356Homeobox domain
PROSITE patternPS000270141164IPR017970Homeobox, conserved site
SuperFamilySSF559615.95E-35294524No hitNo description
PROSITE profilePS5084844.182294525IPR002913START domain
CDDcd088759.55E-129298521No hitNo description
SMARTSM002341.4E-63303522IPR002913START domain
PfamPF018522.3E-59304522IPR002913START domain
Gene3DG3DSA:3.30.530.202.1E-5397516IPR023393START-like domain
SuperFamilySSF559619.45E-25542773No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 782 aa     Download sequence    Send to blast
MPAGIMIPAR NMPSMIGRNG TVGGFGLSSG LSLGQIENHK ASESQRSEEM FQPNLMEAGQ  60
LHPLDMPQNT SESDVPRIRE DDFDSATKSG SENLEGASGE DQDPRPNKKK RYHRHTQHQI  120
QEMEAFFKEC PHPDDKQRKE LSRELGLEPL QVKFWFQNKR TQMKTQHERH ENTQLRTENE  180
KLRADNMRFR EALGNASCPN CGGPTAIGEM SFDEHHLRLE NARLREEIDR ISAIAAKYVG  240
KPVVSYPLVS PSSIPPRPLE LGIGGGFGGQ PGGTGGDMYG GAAGDLLRSI SGPTEADKPI  300
IIELAVAAME ELIGMAQMGE PLWLTTLDGT TVLNEDEYIR SFPRGIGPKP AGFKFEASRE  360
TAVVIMNHVN LVEILMDVNQ WSTVFAGIVS RAMTLEVLST GVAGNYNGAL QVMTAEVQVP  420
SPLVPTRESY FVRYCKQHGD GTWAVVDVSL DNLRPSPSAR CRRRPSGCLI QEMPNGYSKV  480
IWVEHVEVDD RGVHNLYKQL VSSGHAFGAK RWVATLDRQC ERLASAMATN IPTVDVGVIT  540
NQDGRKSMLK LAERMVISFC AGVSASTAHT WTTLSGTGAD DVRVMTRKSV DDPGRPPGIV  600
LSAATSFWLP VSPKRVFEFL RDENSRSEWD ILSNGGVVQE MAHIANGRDT GNCVSLLRVN  660
SANSSQSNML ILQESCADST GSFVIYAPVD IVAMNVVLNG GDPDYVALLP SGFAILPDGT  720
TAHGGGIGDT GHGGSLLTVA FQILVDSVPT AKLSLGSVAT VNNLIACTVE RIKAALSGEV  780
A*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.7950.0cotyledon| flower| leaf| somatic embryo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311700.0KT031170.1 Glycine max clone HN_CCL_122 homeodomain/HOMEOBOX transcription factor (Glyma13g38430.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006594895.10.0PREDICTED: homeobox-leucine zipper protein HDG2
RefseqXP_003543387.10.0PREDICTED: homeobox-leucine zipper protein HDG2
SwissprotQ94C370.0HDG2_ARATH; Homeobox-leucine zipper protein HDG2
TrEMBLA0A0K2CTA40.0A0A0K2CTA4_SOYBN; Homeodomain/HOMEOBOX transcription factor (Fragment)
TrEMBLI1M4360.0I1M436_SOYBN; Uncharacterized protein
STRINGGLYMA13G38430.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15083499
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G05230.40.0homeodomain GLABROUS 2
Publications ? help Back to Top
  1. Chai C, et al.
    Soybean transcription factor ORFeome associated with drought resistance: a valuable resource to accelerate research on abiotic stress resistance.
    BMC Genomics, 2015. 16: p. 596
    [PMID:26268547]